Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Asgr2 Protein

This Rat Asgr2 Protein spans the amino acid sequence from region 1-301aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ASGP-R 2) (ASGPR 2) (Hepatic lectin R2/3) (HL-2) (rHL-2)

UniProt

P08290

Expression Region

1-301aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKDFQDIQQLDSEENDHQLIGDEEQGSHVQNLRTENPRWGGQPPSRPFPQRLCSKFRLSLLALAFNILLLVVICVVSSQSMQLQKEFWTLKETLSNFSTTTLMEFKALDSHGGSRNDNLTSWETILEKKQKDIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDKDGSWKWVDGTEYRSNFKNWAFTQPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKRDITY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Phospho Tau (s396) ELISA Kit
GTR10327374 96 Well

Canine Phospho Tau (s396) ELISA Kit

Sign In for Pricing
View Details
Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF803318 100 µg

Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

Sign In for Pricing
View Details
HMGB2 Rabbit Polyclonal Antibody
orb184215-01 50 μL

HMGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGB2 Rabbit Polyclonal Antibody
orb184215-02 100 µL

HMGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGB2 Rabbit Polyclonal Antibody
orb184215-03 200 µL

HMGB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC39 Antibody - N-terminal region (ARP67433_P050)
ARP67433_P050 100 µL

CCDC39 Antibody - N-terminal region (ARP67433_P050)

Sign In for Pricing
View Details