Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPR15 Protein

This Human GPR15 Protein spans the amino acid sequence from region 1-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Brother of Bonzo) (BoB)

UniProt

P49685

Expression Region

1-360aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Plxdc2 Antibody [Alexa Fluor 700]
NBP1-76858AF700 0.1 mL

Rabbit Polyclonal Plxdc2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Monoclonal VSTM1 Antibody (1A5)
NBP3-11296 50 µg

Mouse Monoclonal VSTM1 Antibody (1A5)

Sign In for Pricing
View Details
SPOP Recombinant Antibody
bsm-62082R-01 20 µL

SPOP Recombinant Antibody

Sign In for Pricing
View Details
SPOP Recombinant Antibody
bsm-62082R-02 100 µL

SPOP Recombinant Antibody

Sign In for Pricing
View Details
Phospho-TIE2 (Tyr1108) Rabbit Polyclonal Antibody (Cy7)
orb1057013 100 µL

Phospho-TIE2 (Tyr1108) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Mouse IgG1 Kappa Isotype Control (mAb, Carrier free, MALS verified)
DNP-M1-100ug 100 µg

Mouse IgG1 Kappa Isotype Control (mAb, Carrier free, MALS verified)

Sign In for Pricing
View Details