Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse P2ry1 Protein

This Mouse P2ry1 Protein spans the amino acid sequence from region 1-373aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(P2Y1) (ADP receptor) (Purinergic receptor)

UniProt

P49650

Expression Region

1-373aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIPA1L1 polyclonal antibody
BS77735-01 50 µL

SIPA1L1 polyclonal antibody

Sign In for Pricing
View Details
SIPA1L1 polyclonal antibody
BS77735-02 100 µL

SIPA1L1 polyclonal antibody

Sign In for Pricing
View Details
Lentiviral human APOC2 sgRNA gene knockout kit - Lentiviral human APOC2 sgRNA gene knockout kit (25)
GTR15395004 1 Vial

Lentiviral human APOC2 sgRNA gene knockout kit - Lentiviral human APOC2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3) (FITC)
304621-01 50 µg

AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3) (FITC)

Sign In for Pricing
View Details
AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3) (FITC)
304621-02 100 µg

AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3) (FITC)

Sign In for Pricing
View Details
JNJ-7706621
C16208-2mg 2 mg

JNJ-7706621

Sign In for Pricing
View Details