Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccr1 Protein

This Mouse Ccr1 Protein spans the amino acid sequence from region 1-355aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(C-C CKR-1) (CC-CKR-1) (CCR-1) (CCR1) (Macrophage inflammatory protein 1-alpha receptor) (MIP-1alpha-R) (RANTES-R) (CD antigen CD191)

UniProt

P51675

Expression Region

1-355aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCER1G Antibody (HRP)
orb239512-01 50 µg

FCER1G Antibody (HRP)

Sign In for Pricing
View Details
FCER1G Antibody (HRP)
orb239512-02 100 µg

FCER1G Antibody (HRP)

Sign In for Pricing
View Details
PRL Mouse mAb, BF700 conjugated
orb2844112 100 µL

PRL Mouse mAb, BF700 conjugated

Sign In for Pricing
View Details
APOM Protein Vector (Mouse) (pPB-N-His)
PV155379 500 ng

APOM Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
V-type proton ATPase subunit C 2 Antibody (Fluoro550)
orb3166095 100 µg

V-type proton ATPase subunit C 2 Antibody (Fluoro550)

Sign In for Pricing
View Details
Bone Morphogenic Protein Receptor 1A (CD292, BMPR-1A, Bone Morphogenetic Protein Receptor Type IA, Serine Threonine Protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, ACVRLK3) (MaxLight 405) discontinued
B2553-60B-ML405 100 µL

Bone Morphogenic Protein Receptor 1A (CD292, BMPR-1A, Bone Morphogenetic Protein Receptor Type IA, Serine Threonine Protein Kinase Receptor R5, SKR5, Activin Receptor-like Kinase 3, ALK-3, ACVRLK3) (MaxLight 405) discontinued

Sign In for Pricing
View Details