Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Avian infectious bronchitis virus Spike glycoprotein Protein

This Avian infectious bronchitis virus Spike glycoprotein Protein spans the amino acid sequence from region 317-537aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

UniProt

P12650

Expression Region

317-537aa

Tag

C-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESNFMYGSYHPSCSFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPLLCKGVYSGELDHNFECGLLVYVTKSGGSRIQTATEPPVITQHNYNNITLNTCVDYNIYGRIGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQSEYGLNYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REG1B ELISA Kit (Human)
OKCD08682-96W 96 Well

REG1B ELISA Kit (Human)

Sign In for Pricing
View Details
mmu-miR-3572-5p miRNA Antagomir
MNM01955 2x 5.0 nmol

mmu-miR-3572-5p miRNA Antagomir

Sign In for Pricing
View Details
General species Cholic Acid (CA)(Competitive EIA) ELISA Kit
MBS2709740-01 24 Strip Well

General species Cholic Acid (CA)(Competitive EIA) ELISA Kit

Sign In for Pricing
View Details
General species Cholic Acid (CA)(Competitive EIA) ELISA Kit
MBS2709740-02 48 Well

General species Cholic Acid (CA)(Competitive EIA) ELISA Kit

Sign In for Pricing
View Details
General species Cholic Acid (CA)(Competitive EIA) ELISA Kit
MBS2709740-03 96 Well

General species Cholic Acid (CA)(Competitive EIA) ELISA Kit

Sign In for Pricing
View Details
General species Cholic Acid (CA)(Competitive EIA) ELISA Kit
MBS2709740-04 5x 96 Well

General species Cholic Acid (CA)(Competitive EIA) ELISA Kit

Sign In for Pricing
View Details