Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human STEAP1B Protein

This Human STEAP1B Protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6NZ63

Expression Region

1-245aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATZ1 antibody - N-terminal region
MBS3204429-01 0.1 mL

PATZ1 antibody - N-terminal region

Sign In for Pricing
View Details
PATZ1 antibody - N-terminal region
MBS3204429-02 5x 0.1 mL

PATZ1 antibody - N-terminal region

Sign In for Pricing
View Details
Mizagliflozin
BA6946-5 5 mg

Mizagliflozin

Sign In for Pricing
View Details
CD52 (CD52 Antigen, CD52 Molecule, CDw52, Cambridge Pathology 1 Antigen, CAMPATH 1, CAMPATH-1 Antigen, Epididymal Secretory Protein E5, HE5) (HRP) discontinued
C2407-50L-HRP 100 µL

CD52 (CD52 Antigen, CD52 Molecule, CDw52, Cambridge Pathology 1 Antigen, CAMPATH 1, CAMPATH-1 Antigen, Epididymal Secretory Protein E5, HE5) (HRP) discontinued

Sign In for Pricing
View Details
Polyclonal Goat Anti-ROR1 Antibody (C-Terminus (near))
APR12171G 0.1mg

Polyclonal Goat Anti-ROR1 Antibody (C-Terminus (near))

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to High Density Lipoprotein Binding Protein (HDLBP)
MBS2066412-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to High Density Lipoprotein Binding Protein (HDLBP)

Sign In for Pricing
View Details