Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLDN4-VLPs Protein

This Human CLDN4-VLPs Protein spans the sequence from region 1-209aa.

Product Specifications

Product Name Alternative

(Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)

UniProt

O14493

Expression Region

1-209aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.

Form

Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSL6 polyclonal antibody
BS72377-01 50 µL

ACSL6 polyclonal antibody

Sign In for Pricing
View Details
ACSL6 polyclonal antibody
BS72377-02 100 µL

ACSL6 polyclonal antibody

Sign In for Pricing
View Details
NSF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1457207 1.0 µg DNA

NSF sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LBP Rabbit Polyclonal Antibody
orb628389-01 50 µg

LBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LBP Rabbit Polyclonal Antibody
orb628389-02 100 µg

LBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-EGR Antibody
DL90373A-01 50 µL

Rabbit anti-EGR Antibody

Sign In for Pricing
View Details