Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ITGAM Protein

This Human ITGAM Protein spans the amino acid sequence from region 46-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)

UniProt

P11215

Expression Region

46-150aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASP2 Antibody
MBS7131418-01 0.1 mL

MASP2 Antibody

Sign In for Pricing
View Details
MASP2 Antibody
MBS7131418-02 5x 0.1 mL

MASP2 Antibody

Sign In for Pricing
View Details
Homeobox Protein VENTX (VENTX) Antibody
abx141987-01 50 µL

Homeobox Protein VENTX (VENTX) Antibody

Sign In for Pricing
View Details
Homeobox Protein VENTX (VENTX) Antibody
abx141987-02 100 µL

Homeobox Protein VENTX (VENTX) Antibody

Sign In for Pricing
View Details
Homeobox Protein VENTX (VENTX) Antibody
abx141987-03 200 µL

Homeobox Protein VENTX (VENTX) Antibody

Sign In for Pricing
View Details
SLAMF7 Protein Lysate (Rat) with C-HA Tag
43857036 100 µg

SLAMF7 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details