Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRPV1 Protein

This Human TRPV1 Protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TrpV1) (Capsaicin receptor) (Osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1)

UniProt

Q8NER1

Expression Region

1-155aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

69.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLFQGPLGSPEFRTMKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQR PGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSI TPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHLDPKNLIRVMVHV VAIALIDGFRPLTWSPRSLWTLSKLDTLTLSSVYSFDYKDFADSGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-Acetyl-L-homoserine Hydrochloride, 95%
TRC-A178300-25MG 25 mg

O-Acetyl-L-homoserine Hydrochloride, 95%

Sign In for Pricing
View Details
2-(2-(Benzylamino)-2-oxoethyl)-5-(4-(2-morpholinoethoxy)phenyl)pyridine 1-oxide
TRC-B889520-50MG 50 mg

2-(2-(Benzylamino)-2-oxoethyl)-5-(4-(2-morpholinoethoxy)phenyl)pyridine 1-oxide

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF640R conjugate, 0.1mg/mL
BNC402859-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (CLIP/2859R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Cilazapril (Ethyl-D5)
TRC-N134285-10MG 10 mg

N-Nitroso Cilazapril (Ethyl-D5)

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF647 conjugate, 0.1mg/mL
BNC472062-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Cyanophenylhydrazine Hydrochloride
TRC-C987535-1G 1 g

4-Cyanophenylhydrazine Hydrochloride

Sign In for Pricing
View Details