Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2A1 Protein

This Human BCL2A1 Protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)

UniProt

Q16548

Expression Region

1-175aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF3 siRNA (Human)
MBS8208152-01 15 nmol

NDUFAF3 siRNA (Human)

Sign In for Pricing
View Details
NDUFAF3 siRNA (Human)
MBS8208152-02 30 nmol

NDUFAF3 siRNA (Human)

Sign In for Pricing
View Details
NDUFAF3 siRNA (Human)
MBS8208152-03 5x 30 nmol

NDUFAF3 siRNA (Human)

Sign In for Pricing
View Details
LTA Human Over-expression Lysate
orb1359890 20 µg

LTA Human Over-expression Lysate

Sign In for Pricing
View Details
CD63
CR024-1ml 1 mL

CD63

Sign In for Pricing
View Details
Samd11 ORF Vector (Mouse) (pORF)
ORF056642 1.0 µg DNA

Samd11 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details