Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADRB2 Protein

This Human ADRB2 Protein spans the amino acid sequence from region 330-413aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Beta-2 adrenoreceptor) (Beta-2 adrenoceptor)

UniProt

P07550

Expression Region

330-413aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PDFRIAFQELLCLRRSSLKAYGNGYSSNGNTGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp7 AAV siRNA Pooled Vector
45166166 1.0 µg

Sp7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
2,3-Dibromopropene
TRC-D426408-5G 5 g

2,3-Dibromopropene

Sign In for Pricing
View Details
ANXA13 cDNA Clone
MBS1268963-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ANXA13 cDNA Clone

Sign In for Pricing
View Details
ANXA13 cDNA Clone
MBS1268963-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ANXA13 cDNA Clone

Sign In for Pricing
View Details
RPL31P30 Adenovirus (Human)
41371051 1.0 mL

RPL31P30 Adenovirus (Human)

Sign In for Pricing
View Details
Hsa-miR-6788-5p miRNA Mimic
CMH2239-01 5 nmol

Hsa-miR-6788-5p miRNA Mimic

Sign In for Pricing
View Details