Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cyp3a25 Protein

This Mouse Cyp3a25 Protein spans the amino acid sequence from region 1-503aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CYPIIIA25)

UniProt

O09158

Expression Region

1-503aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELIPNLSIETWVLLVTSLVLFYIYGTYSHGLFKKLGIPGPKPLPLLGTIFNYYDGMWKFDEDCYKKYGKIWGFYEGPQPILAIMDPEIIKIVLVKECYSVFTNRRFFGPVGFMKKAITISEDEEWKRLRTLLSPTFTSGKLKEMFPIMRQYGDILVRNLRREEEKGEPISMKDIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFKIFDPFLLSIILFPFLTPIYEMLNFSIFPRDSMNFFKKFVKRMKKERLASNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAVIFIFGGYDATSTSISLIMYELATHPDVQKKLQDEIDRTLPNKAPVTYDALMDMEYLDMVVNESLRLYPIAIRLERVSKKDVEINGVFIPKGTVVMIPIYPLHRNPEYWPEPQEFCPERFSKENKGNIDPYIYMPFGNGPRNCIGMRFALISIKLAVIGVLQNFTVQPCEETQIPLKISREPIFQPEKPIILKVVSRDKPRTGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus LAG3 HEK293 Overexpression Lysate
MBS8118020-01 0.3 mg

Cynomolgus LAG3 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Cynomolgus LAG3 HEK293 Overexpression Lysate
MBS8118020-02 5x 0.3 mg

Cynomolgus LAG3 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
1-Naphtholbenzein (pH Indicator)
01781 00005 5 g

1-Naphtholbenzein (pH Indicator)

Sign In for Pricing
View Details
ID2 Rabbit Polyclonal Antibody
orb738450 100 µg

ID2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olr1432 Protein Vector (Rat) (pPM-C-HA)
PV288152 500 ng

Olr1432 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 2 Prolipoprotein diacylglyceryl transferase (lgt)
MBS7018770-01 0.02 mg

Recombinant Streptococcus pneumoniae serotype 2 Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details