Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP3A43 Protein

This Human CYP3A43 Protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9HB55

Expression Region

1-393aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3B Plasmid
PVT7113 2 µg

GSK3B Plasmid

Sign In for Pricing
View Details
Nsd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4887008 1.0 µg DNA

Nsd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CuL3 (NM_016716) Mouse Recombinant Protein
TP510550 20 µg

CuL3 (NM_016716) Mouse Recombinant Protein

Sign In for Pricing
View Details
DHCR7 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-5057R-BF750 100 µL

DHCR7 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Human DnaJ homolog subfamily C member 14 (DNAJC14), partial
MBS7087836 Inquire

Recombinant Human DnaJ homolog subfamily C member 14 (DNAJC14), partial

Sign In for Pricing
View Details
HLA-B (HLA Class I Histocompatibility antigen, B-15 alpha Chain, MHC class I antigen B*15, HLA-B, HLAB) (MaxLight 490) discontinued
302486-ML490 100 µL

HLA-B (HLA Class I Histocompatibility antigen, B-15 alpha Chain, MHC class I antigen B*15, HLA-B, HLAB) (MaxLight 490) discontinued

Sign In for Pricing
View Details