Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CYP3A43 Protein

This Human CYP3A43 Protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9HB55

Expression Region

1-393aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRRSLNKIPSWAWWLTPVIPALWEAEAGGSPKVRSSRPALPTWVFGILTENVMKNTEKCGALFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIVLKVHLRDGITSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DiagNano™ NIR CdSeTe/ZnS Quantum Dots, 840 nm
DNG-N075 10 mg

DiagNano™ NIR CdSeTe/ZnS Quantum Dots, 840 nm

Sign In for Pricing
View Details
Recombinant Dog Cholinesterase (BCHE)
orb1651387-01 20 µg

Recombinant Dog Cholinesterase (BCHE)

Sign In for Pricing
View Details
Recombinant Dog Cholinesterase (BCHE)
orb1651387-02 100 µg

Recombinant Dog Cholinesterase (BCHE)

Sign In for Pricing
View Details
Recombinant Dog Cholinesterase (BCHE)
orb1651387-03 1 mg

Recombinant Dog Cholinesterase (BCHE)

Sign In for Pricing
View Details
WDR92 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17836 0.1 mg

WDR92 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Hsa-miR-3663-3p miRNA Mimic
orb1877619-01 5 nmol

Hsa-miR-3663-3p miRNA Mimic

Sign In for Pricing
View Details