Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FabI Protein

This fabI Protein spans the amino acid sequence from region 2-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ENR) (NADH-dependent enoyl-ACP reductase)

UniProt

P0AEK5

Expression Region

2-262aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNELELK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPIN3 Polyclonal Antibody, Biotin Conjugated
A65137-050 50 µL

SPIN3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PLA2G2C CytoSection
TS425128P5 25 Slides

PLA2G2C CytoSection

Sign In for Pricing
View Details
hsa-miR-122-5p miRNA Mimic
MCH01089 2x 2.5 nmol

hsa-miR-122-5p miRNA Mimic

Sign In for Pricing
View Details
DCX Antibody, FITC conjugated
A19085-100UG 100 µg

DCX Antibody, FITC conjugated

Sign In for Pricing
View Details
LARP1 antibody
FNab04698 100 µg

LARP1 antibody

Sign In for Pricing
View Details
Mouse Tyrosine-protein kinase ZAP-70 (ZAP70) ELISA Kit
abx520704 96 Tests

Mouse Tyrosine-protein kinase ZAP-70 (ZAP70) ELISA Kit

Sign In for Pricing
View Details