Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit TSLP Protein

This Rabbit TSLP Protein spans the amino acid sequence from region 29-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

G1TYN9

Expression Region

29-149aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSFTNCDFGKIRKKYEKIIYPALEKYMQGVSKETFSLKKIYCLSTIERDTFTPTPGCASLPTADFARKTWAVFALRCPGYSRVQINSLQEVKKGEDTTNNCLEKASHLLGLWRRFSRISEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAA13 3'UTR Lenti-reporter-Luc Vector
47881081 1.0 µg

TRNAA13 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PARP1-IN-37
HY-171543 1 Each

PARP1-IN-37

Sign In for Pricing
View Details
Human Rectal Mucosal Epithelial Cell Complete Medium
CM-H041-01 100 mL

Human Rectal Mucosal Epithelial Cell Complete Medium

Sign In for Pricing
View Details
Human Rectal Mucosal Epithelial Cell Complete Medium
CM-H041-02 4x 125 mL

Human Rectal Mucosal Epithelial Cell Complete Medium

Sign In for Pricing
View Details
Recombinant Human TNF RI/TNFRSF1A Protein, His Tag
E40KMH1817 20 µg

Recombinant Human TNF RI/TNFRSF1A Protein, His Tag

Sign In for Pricing
View Details
ODF4 Protein Lysate (Rat) with C-HA Tag
32448036 100 µg

ODF4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details