Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein

This Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DHNA-CoA hydrolase) (DHNA-CoA thioesterase)

UniProt

P77781

Expression Region

1-136aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIWKRKITLEALNAMGEGNMVGFLDIRFEHIGDDTLEATMPVDSRTKQPFGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCCSSRLTTAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) Guinea Pig Polyclonal Antibody
BP5080 100 µL

Cytokeratin 20 (KRT20) Guinea Pig Polyclonal Antibody

Sign In for Pricing
View Details
HLA-DRB1 Human, Sf9
32-13259-1 1 µg

HLA-DRB1 Human, Sf9

Sign In for Pricing
View Details
Snd1 ORF Vector (Mouse) (pORF)
44545014 1.0 µg DNA

Snd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RMC-6236
E1597-100mg 100 mg

RMC-6236

Sign In for Pricing
View Details
Rabbit Anti-Horse IgG (H&L) FITC
E38A2325 100 µL

Rabbit Anti-Horse IgG (H&L) FITC

Sign In for Pricing
View Details
LAG-3, Fc, Recombinant, Mouse (Lymphocyte Activation Gene-3, FDC Protein, CD223) discontinued
044995 500 µg

LAG-3, Fc, Recombinant, Mouse (Lymphocyte Activation Gene-3, FDC Protein, CD223) discontinued

Sign In for Pricing
View Details