Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EsaB Protein

This esaB Protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C050

Expression Region

1-80aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIFDVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCER2 Antibody
OAAF08257-50UL 0.05 mL

FCER2 Antibody

Sign In for Pricing
View Details
Cynomolgus Monkey Skeletal Muscle Genomic DNA
NHP-DA010 Each

Cynomolgus Monkey Skeletal Muscle Genomic DNA

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31.12), CF640R conjugate, 0.1mg/mL
BNC401250-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bsdc1 (NM_133889) Mouse Tagged ORF Clone
MR206806 10 µg

Bsdc1 (NM_133889) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CASP8 Antibody
orb688476-01 50 µg

CASP8 Antibody

Sign In for Pricing
View Details
CASP8 Antibody
orb688476-02 100 µg

CASP8 Antibody

Sign In for Pricing
View Details