Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF22 Protein

This Human FGF22 Protein spans the amino acid sequence from region 23-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-22)

UniProt

Q9HCT0

Expression Region

23-170aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 633 Anti-human CD169 Antibody *7-239*
116900E0-AAT 100 Tests

IFluor® 633 Anti-human CD169 Antibody *7-239*

Sign In for Pricing
View Details
ADAM33 CRISPR Knock Out 293T Cell Line (Human)
11333141 1x 10^6 Cells / 1.0 mL

ADAM33 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
OR6N2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1529808 1.0 µg DNA

OR6N2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC16A3 sgRNA CRISPR Lentivector set (Human)
K2169201 3x 1.0 µg

SLC16A3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GPSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV811140 1.0 µg DNA

GPSN2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ZBTB26 (NM_020924) Human Over-expression Lysate
LS057684 100 µg

ZBTB26 (NM_020924) Human Over-expression Lysate

Sign In for Pricing
View Details