Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NOTUM Protein

This Human NOTUM Protein spans the amino acid sequence from region 20-496aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(hNOTUM)

UniProt

Q6P988

Expression Region

20-496aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF98 (TRIM36) Rabbit Polyclonal Antibody
TA356286 100 µL

RNF98 (TRIM36) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYCE2 shRNA (h) Lentiviral Particles
sc-106961-V 200 µL

SYCE2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Ncs1 Rat shRNA Plasmid (Locus ID 65153)
TL711028 1 Kit

Ncs1 Rat shRNA Plasmid (Locus ID 65153)

Sign In for Pricing
View Details
CST5 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV646973 1.0 µg DNA

CST5 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HP, ID (HP, Haptoglobin, Zonulin, Haptoglobin alpha chain, Haptoglobin beta chain) (Azide free) (HRP) discontinued
036741-HRP 200 µL

HP, ID (HP, Haptoglobin, Zonulin, Haptoglobin alpha chain, Haptoglobin beta chain) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Guinea Pig Monoamine Oxidase ELISA kit
GTR10435746 96 Well

Guinea Pig Monoamine Oxidase ELISA kit

Sign In for Pricing
View Details