Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis angusticeps Dendrotoxin B Protein

This Dendroaspis angusticeps Dendrotoxin B Protein spans the amino acid sequence from region 1-30aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-B)

UniProt

Q9PS09

Expression Region

1-30aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MICYSHKTPQPSATIGCEEKTCYKKSVRKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coagulation factor XIII A Recombinant Antibody, PerCP Conjugated
bsm-61604R-PerCP-01 20 µL

Coagulation factor XIII A Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Coagulation factor XIII A Recombinant Antibody, PerCP Conjugated
bsm-61604R-PerCP-02 100 µL

Coagulation factor XIII A Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
PsaJ Antibody
orb837129 2 mg

PsaJ Antibody

Sign In for Pricing
View Details
BMP15 Rabbit Polyclonal Antibody
TA374026 100 µL

BMP15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Tnfrsf12a ELISA KIT (1 x 96 wells)
EA102524 96 Well

Mouse Tnfrsf12a ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
PKM2 Rabbit mAb
MBS4763905-01 0.1 mL

PKM2 Rabbit mAb

Sign In for Pricing
View Details