Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Aldh2 Protein

This Rat Aldh2 Protein spans the amino acid sequence from region 20-519aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ALDH class 2) (ALDH-E2) (ALDH1)

UniProt

P11884

Expression Region

20-519aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRPM (HNRNPM) Rabbit Polyclonal Antibody
TA384447 100 µL

HNRPM (HNRNPM) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Protein Zero, Myelin (MPZ) ELISA Kit
RD-MPZ-Hu-01 96 Tests

Human Protein Zero, Myelin (MPZ) ELISA Kit

Sign In for Pricing
View Details
Human Protein Zero, Myelin (MPZ) ELISA Kit
RD-MPZ-Hu-02 48 Tests

Human Protein Zero, Myelin (MPZ) ELISA Kit

Sign In for Pricing
View Details
MRP8/14 (S100A8/A9) Rabbit Polyclonal Antibody
AP02119SU-N 100 µL

MRP8/14 (S100A8/A9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human XRCC6BP1 (ATP23) activation kit by CRISPRa
GA114113 1 Kit

Human XRCC6BP1 (ATP23) activation kit by CRISPRa

Sign In for Pricing
View Details
OR5A1 (NM_001004728) Human Over-expression Lysate
LY423911 100 µg

OR5A1 (NM_001004728) Human Over-expression Lysate

Sign In for Pricing
View Details