Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oncorhynchus mykiss Interleukin-10 Protein

This Oncorhynchus mykiss Interleukin-10 Protein spans the amino acid sequence from region 24-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6L8N7

Expression Region

24-184aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRVPCSDRCCSFVEGFPVRLKELRTAFSTIRDYYEANDELETSLLDEGILHHLKSPVGCHAMDSILKFYLDTVLPTAMNNRTQNNNDFKSPIDSIGNIFHELKKEIVQCRNYFSCKKPFDINEFISSYEKMQDKGLYKAMGELDLLFNYIEEYLVSKRRKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ambp (NM_007443) Mouse Tagged ORF Clone
MG205283 10 µg

Ambp (NM_007443) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Snhg11 (NM_001258011) Rat Untagged Clone
RN215765 10 µg

Snhg11 (NM_001258011) Rat Untagged Clone

Sign In for Pricing
View Details
Human ALG8 activation kit by CRISPRa
GA112336 1 Kit

Human ALG8 activation kit by CRISPRa

Sign In for Pricing
View Details
Human HLA-DRB1 Protein Lysate 20ug
IHUHLADRB1PLLY20UG 20 µg

Human HLA-DRB1 Protein Lysate 20ug

Sign In for Pricing
View Details
Trifarotene Impurity 3
RM-T184303-01 10 mg

Trifarotene Impurity 3

Sign In for Pricing
View Details
Trifarotene Impurity 3
RM-T184303-02 100 mg

Trifarotene Impurity 3

Sign In for Pricing
View Details