Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VsdF Protein

This vsdF Protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P24421

Expression Region

1-119aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Salmonella dublin

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRHGVSLTPRKDIKPLLAVAKKFRKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKARFPMFKRKHGKLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC25 Rabbit Polyclonal Antibody (HRP)
orb2087690 100 µL

TTC25 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FA83D Rabbit Polyclonal Antibody (BF555)
orb2512145 100 µL

FA83D Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant Acetylcholinesterase (ACHE)
TRV-0054776-01 10 µg

Recombinant Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
Recombinant Acetylcholinesterase (ACHE)
TRV-0054776-02 50 µg

Recombinant Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
Recombinant Acetylcholinesterase (ACHE)
TRV-0054776-03 100 µg

Recombinant Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details
Recombinant Acetylcholinesterase (ACHE)
TRV-0054776-04 200 µg

Recombinant Acetylcholinesterase (ACHE)

Sign In for Pricing
View Details