Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN Protein

This MSTN Protein spans the amino acid sequence from region 19-375aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Myostatin)

UniProt

M3WPT7

Expression Region

19-375aa

Tag

Tag-Free

Source

E.coli

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TGF-beta Antibody (1D11.16.8) [Alexa Fluor 647]
NBP2-45137AF647 0.1 mL

Mouse Monoclonal TGF-beta Antibody (1D11.16.8) [Alexa Fluor 647]

Sign In for Pricing
View Details
Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)
TRV-0062285-01 20 µL

Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)
TRV-0062285-02 100 µL

Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)
TRV-0062285-03 200 µL

Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)
TRV-0062285-04 1 mL

Polyclonal Antibody to Melanoma Antigen Family A3 (MAGEA3)

Sign In for Pricing
View Details
Pgd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3503007 1.0 µg DNA

Pgd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details