Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CT83 Protein (Biotin)

This Human CT83 Protein (Biotin) spans the amino acid sequence from region 22-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(KK-LC-1) (Cancer/testis antigen 83)

UniProt

Q5H943

Expression Region

22-113aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1,N4-Bis-(7-chloroquinolin-4-yl)-N1-ethylpentane-1,4-diamine
TRC-B419140-5MG 5 mg

N1,N4-Bis-(7-chloroquinolin-4-yl)-N1-ethylpentane-1,4-diamine

Sign In for Pricing
View Details
DEFB106B (NM_001040704) Human Over-expression Lysate
LC420748 20 µg

DEFB106B (NM_001040704) Human Over-expression Lysate

Sign In for Pricing
View Details
2,3-Dichloroquinoxaline
TRC-D435955-5G 5 g

2,3-Dichloroquinoxaline

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/3000), CF405S conjugate, 0.1mg/mL
BNC043000-100 1x 100 µL

MCM6 (Proliferation Marker) (MCM6/3000), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SASH3 activation kit by CRISPRa
GA110102 1 Kit

Human SASH3 activation kit by CRISPRa

Sign In for Pricing
View Details
SSX4 (SSX4B) Human Gene Knockout Kit (CRISPR)
KN402758 1 Kit

SSX4 (SSX4B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details