Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterobacteria phage T4 Single-stranded DNA-binding Protein

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

(SSB protein) (Gp32) (Helix-destabilizing protein)

UniProt

P03695

Expression Region

1-301aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vonoprazan chloro impurity hydrochloride salt
TRC-V766995-100MG 100 mg

Vonoprazan chloro impurity hydrochloride salt

Sign In for Pricing
View Details
Human ANKRD63 activation kit by CRISPRa
GA119141 1 Kit

Human ANKRD63 activation kit by CRISPRa

Sign In for Pricing
View Details
Rbm3 (NM_016809) Mouse Tagged ORF Clone
MG201130 10 µg

Rbm3 (NM_016809) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant HSDL2 Antibody
RN-13772-01 50 μL

Recombinant HSDL2 Antibody

Sign In for Pricing
View Details
Recombinant HSDL2 Antibody
RN-13772-02 100 µL

Recombinant HSDL2 Antibody

Sign In for Pricing
View Details
Recombinant HSDL2 Antibody
RN-13772-03 1 mL

Recombinant HSDL2 Antibody

Sign In for Pricing
View Details