Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enterobacteria phage T4 Single-stranded DNA-binding Protein

Recombinant Enterobacteria phage T4 Single-stranded DNA-binding protein (32)

Product Specifications

Product Name Alternative

(SSB protein) (Gp32) (Helix-destabilizing protein)

UniProt

P03695

Expression Region

1-301aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ppara (1-18) Rabbit Polyclonal Antibody
AP07674PU-N 50 µg

Ppara (1-18) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACAT2 (NM_001303253) Human Tagged ORF Clone
RG238154 10 µg

ACAT2 (NM_001303253) Human Tagged ORF Clone

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid-d4 1-(4-Hydroxybutyl) Ester
TRC-B185452-5MG 5 mg

1,2-Benzenedicarboxylic Acid-d4 1-(4-Hydroxybutyl) Ester

Sign In for Pricing
View Details
RNF86 (TRIM2) (NM_001130067) Human Over-expression Lysate
LC427142 20 µg

RNF86 (TRIM2) (NM_001130067) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB501223 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details