Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mycobacteroides abscessus subsp. abscessus ESAT-6-like Protein

This Mycobacteroides abscessus subsp. abscessus ESAT-6-like Protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1N3W156

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacteroides abscessus subsp. abscessus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVFQNDLALLDSTAKKIDGKYQEFTAMQSQLRDRVAVGTSTWQGQARHAFDEAMARFDQEMGDIQKVLIGIHDTMESNKRRIQEMDESQTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SGO2 Antibody Picoband®, Cy3 Conjugate
A08632-Cy3 100 µg/Vial

Anti-SGO2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Hsa-miR-216a-5p miRNA Mimic
CMH0078-01 5 nmol

Hsa-miR-216a-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-216a-5p miRNA Mimic
CMH0078-02 10 nmol

Hsa-miR-216a-5p miRNA Mimic

Sign In for Pricing
View Details
SOX9 (ABT-SOX9) mouse mAb Ready to use
UB-GEN-16879 100 µL

SOX9 (ABT-SOX9) mouse mAb Ready to use

Sign In for Pricing
View Details
SPRED1 (NM_152594) Human Over-expression Lysate
LY407400 100 µg

SPRED1 (NM_152594) Human Over-expression Lysate

Sign In for Pricing
View Details
NBPF18P AAV Vector (Human) (CMV)
31515101 1 µg

NBPF18P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details