Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DBP Protein

This Human DBP Protein spans the amino acid sequence from region 174-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DBP) (Early 2A protein) (Early E2A DNA-binding protein)

UniProt

P03264

Expression Region

174-529aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin Light Chain 9, Regulatory (MYL9) Antibody
abx103355-01 100 µL

Myosin Light Chain 9, Regulatory (MYL9) Antibody

Sign In for Pricing
View Details
Myosin Light Chain 9, Regulatory (MYL9) Antibody
abx103355-02 200 µL

Myosin Light Chain 9, Regulatory (MYL9) Antibody

Sign In for Pricing
View Details
Myosin Light Chain 9, Regulatory (MYL9) Antibody
abx103355-03 1 mL

Myosin Light Chain 9, Regulatory (MYL9) Antibody

Sign In for Pricing
View Details
PSP (REG1A) (NM_002909) Human Over-expression Lysate
LY401018 100 µg

PSP (REG1A) (NM_002909) Human Over-expression Lysate

Sign In for Pricing
View Details
OR52I2 Antibody - N-terminal region : FITC (ARP71314_P050-FITC)
ARP71314_P050-FITC 100 µL

OR52I2 Antibody - N-terminal region : FITC (ARP71314_P050-FITC)

Sign In for Pricing
View Details
TOPBP1 (Topoisomerase 2-binding Protein 1, TOP2BP1) (PE)
MBS6441246-01 0.1 mL

TOPBP1 (Topoisomerase 2-binding Protein 1, TOP2BP1) (PE)

Sign In for Pricing
View Details