Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTN3A1 Protein

This Human BTN3A1 Protein spans the amino acid sequence from region 30-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CD antigen CD277)

UniProt

O00481

Expression Region

30-254aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl (4-nitro-1H-pyrazol-3-yl) acetate
sc-326940 500 mg

Ethyl (4-nitro-1H-pyrazol-3-yl) acetate

Sign In for Pricing
View Details
SPATA20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2268707 1.0 µg DNA

SPATA20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AP26113-analog (ALK-IN-1)
S7000-50mg 50 mg

AP26113-analog (ALK-IN-1)

Sign In for Pricing
View Details
RAB7L1 monoclonal antibody
orb1677439-01 50 µL

RAB7L1 monoclonal antibody

Sign In for Pricing
View Details
RAB7L1 monoclonal antibody
orb1677439-02 100 µL

RAB7L1 monoclonal antibody

Sign In for Pricing
View Details
RAB7L1 monoclonal antibody
orb1677439-03 200 µL

RAB7L1 monoclonal antibody

Sign In for Pricing
View Details