Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dactylis glomerata Major pollen allergen Dac g 4 Protein

This Dactylis glomerata Major pollen allergen Dac g 4 Protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(allergen Dac g 4) (Fragments)

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Canine Vascular Endothelial cell Growth Factor (VEGF) ELISA
KLN0019 1x 96 Well

GENLISA™ Canine Vascular Endothelial cell Growth Factor (VEGF) ELISA

Sign In for Pricing
View Details
SFT2D1 CRISPR Activation Plasmid (m)
sc-430653-ACT 20 µg

SFT2D1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta Induced Protein Chemiluminescent Immunoassay Kit
IHUTGFBIKTC 1 Each

Human Transforming Growth Factor Beta Induced Protein Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
Neuronal Pentraxin II Antibody
abx114085 100 µL

Neuronal Pentraxin II Antibody

Sign In for Pricing
View Details
SF3B3 Antibody
orb2674867-01 50 µL

SF3B3 Antibody

Sign In for Pricing
View Details
SF3B3 Antibody
orb2674867-02 100 µL

SF3B3 Antibody

Sign In for Pricing
View Details