Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Keratinocyte differentiation-associated Protein

This Rat Keratinocyte differentiation-associated Protein spans the amino acid sequence from region 23-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P85411

Expression Region

23-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PEX11B shRNA (UAS) - Lentiviral human PEX11B shRNA (UAS, RFP) plasmid
GTR15344416 1 Vial

Lentiviral human PEX11B shRNA (UAS) - Lentiviral human PEX11B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
STEAP4 (NM_024636) Human Tagged Lenti ORF Clone
RC216917L4 10 µg

STEAP4 (NM_024636) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
DDX21 Double Nickase Plasmid (h2)
sc-405770-NIC-2 20 µg

DDX21 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ENTPD5 Protein, Mouse, Recombinant (His Tag)
E45M53540I2-50 50 µg

ENTPD5 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
4930430F08Rik (NM_175128) Mouse Tagged ORF Clone
MR204792 10 µg

4930430F08Rik (NM_175128) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hamster Opticin ELISA Kit
MBS087953-01 48 Well

Hamster Opticin ELISA Kit

Sign In for Pricing
View Details