Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Keratinocyte differentiation-associated Protein

This Rat Keratinocyte differentiation-associated Protein spans the amino acid sequence from region 23-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P85411

Expression Region

23-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42SE1 (NM_001038707) Human Over-expression Lysate
LC422010 20 µg

CDC42SE1 (NM_001038707) Human Over-expression Lysate

Sign In for Pricing
View Details
PLV3-CMV-IKBKE-3xFLAG-Puro Plasmid
PVT71367 2 µg

PLV3-CMV-IKBKE-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details
TAS2R20 (Taste Receptor Type 2 Member 20, T2R20, Taste Receptor Type 2 Member 49, TAS2R49, T2R49, Taste Receptor Type 2 Member 56, T2R56) (MaxLight 550)
134227-ML550 100 µL

TAS2R20 (Taste Receptor Type 2 Member 20, T2R20, Taste Receptor Type 2 Member 49, TAS2R49, T2R49, Taste Receptor Type 2 Member 56, T2R56) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human RAI14 sgRNA gene knockout kit - Lentiviral human RAI14 sgRNA gene knockout kit (plasmid)
GTR15354244 1 Vial

Lentiviral human RAI14 sgRNA gene knockout kit - Lentiviral human RAI14 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
JAM2, Recombinant, Human, aa29-238, hIgG-His-Tag (Junctional Adhesion Molecule B Isoform 1, JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM)
470244 50 µg

JAM2, Recombinant, Human, aa29-238, hIgG-His-Tag (Junctional Adhesion Molecule B Isoform 1, JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM)

Sign In for Pricing
View Details
MEF2D (Phospho-Ser444) Antibody
8A0510-AAT 50 µg

MEF2D (Phospho-Ser444) Antibody

Sign In for Pricing
View Details