Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Keratinocyte differentiation-associated Protein

This Rat Keratinocyte differentiation-associated Protein spans the amino acid sequence from region 23-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P85411

Expression Region

23-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AALGTPMEDTTSSNYPSGTEGLSEFLNFNKLQSAFKSDDFLNWHVLTDMFKKALPFINWEFFPKVKGLRSAVPDSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GSX1 siRNA
abx918845-01 15 nmol

Mouse GSX1 siRNA

Sign In for Pricing
View Details
Mouse GSX1 siRNA
abx918845-02 30 nmol

Mouse GSX1 siRNA

Sign In for Pricing
View Details
Human COP9 signalosome complex subunit 2 ELISA Kit (Colorimetric)
NBP3-27408 1 Kit

Human COP9 signalosome complex subunit 2 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Atg4c Mouse shRNA Plasmid (Locus ID 242557)
TR511491 1 Kit

Atg4c Mouse shRNA Plasmid (Locus ID 242557)

Sign In for Pricing
View Details
epithelial Sodium Channel alpha (SCNN1A) Rabbit Polyclonal Antibody
TA361270 100 µL

epithelial Sodium Channel alpha (SCNN1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR52E6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1567505 3x 1.0 µg

OR52E6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details