Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ctsz Protein

This Rat Ctsz Protein spans the amino acid sequence from region 64-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cathepsin Y)

UniProt

Q9R1T3

Expression Region

64-306aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS26B (NM_052875) Human Recombinant Protein
TP310499 20 µg

VPS26B (NM_052875) Human Recombinant Protein

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF568 conjugate, 0.1mg/mL
BNC682481-100 1x 100 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS641111 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Equilin
TRC-E592800-25MG 25 mg

Equilin

Sign In for Pricing
View Details
PD-L1 Antibody
KC-27764-01 50 μL

PD-L1 Antibody

Sign In for Pricing
View Details
PD-L1 Antibody
KC-27764-02 100 µL

PD-L1 Antibody

Sign In for Pricing
View Details