Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ctsz Protein

This Rat Ctsz Protein spans the amino acid sequence from region 64-306aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Cathepsin Y)

UniProt

Q9R1T3

Expression Region

64-306aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPKNWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSALADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLPVWEYAHKHGIPDETCNNYQAKDQECDKFNQCGTCTEFKECHTIQNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERMSNYTGGIYTEYQNQAIINHIISVAGWGVSNDGIEYWIVRNSWGEPWGERGWMRIVTSTYKGGTGSSYNLAIEEACTFGDPIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR23 (DCAF11) Rabbit Polyclonal Antibody
TA375338 100 µL

WDR23 (DCAF11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), 1mg/mL
BNUM0010-50 1x 50 µL

MART-1 / Melan-A (M2-9E3), 1mg/mL

Sign In for Pricing
View Details
N-Benzyl Epinephrine-d3
TRC-B276402-5MG 5 mg

N-Benzyl Epinephrine-d3

Sign In for Pricing
View Details
CACNG6 (NM_145814) Human Recombinant Protein
TP305809M 100 µg

CACNG6 (NM_145814) Human Recombinant Protein

Sign In for Pricing
View Details
Thromboxane B2
TRC-T405600-1MG 1 mg

Thromboxane B2

Sign In for Pricing
View Details
alpha 1 Antichymotrypsin (SERPINA3) Mouse Monoclonal Antibody [Clone ID: B4H12]
AM26407PU-L 500 µg

alpha 1 Antichymotrypsin (SERPINA3) Mouse Monoclonal Antibody [Clone ID: B4H12]

Sign In for Pricing
View Details