Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHH Protein

This Human DHH Protein spans the amino acid sequence from region 51-158AA. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DHH) (HHG-3)

UniProt

O43323

Expression Region

51-158AA

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THOC5 Antibody
MBS7132510-01 0.1 mL

THOC5 Antibody

Sign In for Pricing
View Details
THOC5 Antibody
MBS7132510-02 5x 0.1 mL

THOC5 Antibody

Sign In for Pricing
View Details
PIH1D1 (Center) Rabbit pAb
MBS8553541-01 0.1 mL

PIH1D1 (Center) Rabbit pAb

Sign In for Pricing
View Details
PIH1D1 (Center) Rabbit pAb
MBS8553541-02 0.1 mL (AF405L)

PIH1D1 (Center) Rabbit pAb

Sign In for Pricing
View Details
PIH1D1 (Center) Rabbit pAb
MBS8553541-03 0.1 mL (AF405S)

PIH1D1 (Center) Rabbit pAb

Sign In for Pricing
View Details
PIH1D1 (Center) Rabbit pAb
MBS8553541-04 0.1 mL (AF610)

PIH1D1 (Center) Rabbit pAb

Sign In for Pricing
View Details