Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GFUS Protein

This Human GFUS Protein spans the amino acid sequence from region 1-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase) (Protein FX) (Red cell NADP (H) -binding protein) (Short-chain dehydrogenase/reductase family 4E member 1)

UniProt

Q13630

Expression Region

1-321aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menthol acetate
89-48-5 1 Each

Menthol acetate

Sign In for Pricing
View Details
Research Grade Anti-Human CLDN6 Antibody (64A)
HX940076-01 100 µg

Research Grade Anti-Human CLDN6 Antibody (64A)

Sign In for Pricing
View Details
Research Grade Anti-Human CLDN6 Antibody (64A)
HX940076-02 1 mg

Research Grade Anti-Human CLDN6 Antibody (64A)

Sign In for Pricing
View Details
CD27 Antibody
orb1312928 100 µL

CD27 Antibody

Sign In for Pricing
View Details
Guinea Pig Interleukin 30 ELISA Kit
MBS7257899-01 48 Well

Guinea Pig Interleukin 30 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Interleukin 30 ELISA Kit
MBS7257899-02 96 Well

Guinea Pig Interleukin 30 ELISA Kit

Sign In for Pricing
View Details