Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Col4a3 Protein

This Mouse Col4a3 Protein spans the amino acid sequence from region 1424-1669aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9QZS0

Expression Region

1424-1669aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRAMEF19 shRNA (UAS) - Lentiviral human PRAMEF19 shRNA (UAS, iRFP) (100)
GTR15101139 1 Vial

Lentiviral human PRAMEF19 shRNA (UAS) - Lentiviral human PRAMEF19 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
OTOP2 rabbit pAb
UB-GEN-7817 100 µL

OTOP2 rabbit pAb

Sign In for Pricing
View Details
PKIB (Protein Kinase (cAMP-Dependent, Catalytic) Inhibitor beta, FLJ23817, PRKACN2) (MaxLight 650)
250146-ML650 100 µL

PKIB (Protein Kinase (cAMP-Dependent, Catalytic) Inhibitor beta, FLJ23817, PRKACN2) (MaxLight 650)

Sign In for Pricing
View Details
Human ATP2B2 qPCR Primer Pair
QH10761S 200 Tests

Human ATP2B2 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Sphingosine 1 Phosphate Receptor 1 (S1PR1) Polyclonal antibody
FY-AB38356-01 1 mL

Anti-Sphingosine 1 Phosphate Receptor 1 (S1PR1) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Sphingosine 1 Phosphate Receptor 1 (S1PR1) Polyclonal antibody
FY-AB38356-02 100 µL

Anti-Sphingosine 1 Phosphate Receptor 1 (S1PR1) Polyclonal antibody

Sign In for Pricing
View Details