Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pasteurella multocida Peptidoglycan-associated lipoprotein Protein

This Pasteurella multocida Peptidoglycan-associated lipoprotein Protein spans the amino acid sequence from region 20-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PAL) (Outer membrane protein P6) (OMP P6) (P6-like)

UniProt

Q51886

Expression Region

20-150aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGSSKKDESAGQMFGGYSVQDLQQRYNTVYFGFDKYNIEGEYVQILDAHAAFLNATPATKVVVEGNTDERGTPEYNIALGQRRADAVKHYLSAKGVQAGQVSTVSYGEEKPAVLGHDEAAYSKNRRAVLAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HGFR/c-MET Protein (aa 25-932, His Tag)
PKSH032535-01 10 µg

Recombinant Human HGFR/c-MET Protein (aa 25-932, His Tag)

Sign In for Pricing
View Details
Recombinant Human HGFR/c-MET Protein (aa 25-932, His Tag)
PKSH032535-02 50 µg

Recombinant Human HGFR/c-MET Protein (aa 25-932, His Tag)

Sign In for Pricing
View Details
Acyp2 Mouse Gene Knockout Kit (CRISPR)
KN500809 1 Kit

Acyp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stool DNA Isolation Kit
27600 50 Preparations

Stool DNA Isolation Kit

Sign In for Pricing
View Details
Mouse MCSF Antibody Pair Set
E-KAB-0591 50 µL & 100 µg

Mouse MCSF Antibody Pair Set

Sign In for Pricing
View Details
Homeo box C10 (HOXC10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]
TA808867AM 100 µL

Homeo box C10 (HOXC10) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A11]

Sign In for Pricing
View Details