Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xenopus pparg Protein

This Xenopus pparg Protein spans the amino acid sequence from region 1-477aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PPAR-gamma) (Nuclear receptor subfamily 1 group C member 3)

UniProt

P37234

Expression Region

1-477aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVDTEMPFWSNLNFGMNSMDMSALEDHCQPYDIKPFTTVDFSSINSHYDDILDEKTFLCRNDQSPIDYKYDLKLQECQSSIKLEPPSPPYFSDKPQCSKAFEDTPNSFIAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYERCDLNCRIHKKSRNKCQFCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADQRVLAKHLYDSYVKSFPLTKAKAPGHPDGQSHRQNSRGYTRHELADDGGGSDQGAVREPRAEQGGGDSNLPALSVALRGGVREITEFAKNIPGFVSLDLNDQVTLLKYGVHEIIFTMLASLMNKDGVLVAEGQGFMTREFLKSLRKPFSDFMEPKFEFAIRFNSLELDDSDLAIFVAVIILSGDRPGLLNVKPIEDIQDSLLQALELQLKLNHPDSAQLFAKLLQKMTDLRQVVTEHVQLLQLIKKTEADMCLHPLLQEIYKDLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRELID1 (PRELI Domain-containing Protein 1, Mitochondrial, PRELI, 25kD Protein of Relevant Evolutionary and Lymphoid Interest, CGI-106, PX19, Px19-like Protein, SBBI12) (FITC)
MBS6149145-01 0.1 mL

PRELID1 (PRELI Domain-containing Protein 1, Mitochondrial, PRELI, 25kD Protein of Relevant Evolutionary and Lymphoid Interest, CGI-106, PX19, Px19-like Protein, SBBI12) (FITC)

Sign In for Pricing
View Details
PRELID1 (PRELI Domain-containing Protein 1, Mitochondrial, PRELI, 25kD Protein of Relevant Evolutionary and Lymphoid Interest, CGI-106, PX19, Px19-like Protein, SBBI12) (FITC)
MBS6149145-02 5x 0.1 mL

PRELID1 (PRELI Domain-containing Protein 1, Mitochondrial, PRELI, 25kD Protein of Relevant Evolutionary and Lymphoid Interest, CGI-106, PX19, Px19-like Protein, SBBI12) (FITC)

Sign In for Pricing
View Details
TCTP Rabbit Polyclonal Antibody (BF555)
orb2428679 100 µL

TCTP Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Chordc1 ORF Vector (Mouse) (pORF)
ORF041336 1.0 µg DNA

Chordc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PEGFP-C3-ODC1
PPL01279-2a 1 Each

PEGFP-C3-ODC1

Sign In for Pricing
View Details
Mouse Khdrbs1 Rabbit Polyclonal Antibody (C-term)
E28PB1910 100 µL

Mouse Khdrbs1 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details