Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SplB Protein

This splB Protein spans the amino acid sequence from region 37-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A7X3Q8

Expression Region

37-240aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENNVTKIQDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YSI2300 Glu/Lac Ana Lactate Std - 125ML
Y2328 125 mL

YSI2300 Glu/Lac Ana Lactate Std - 125ML

Sign In for Pricing
View Details
ABCD1 Antibody (Biotin)
orb414584-01 50 µg

ABCD1 Antibody (Biotin)

Sign In for Pricing
View Details
ABCD1 Antibody (Biotin)
orb414584-02 100 µg

ABCD1 Antibody (Biotin)

Sign In for Pricing
View Details
Anti-HEXA Antibody Picoband® Fluoro647 Conjugated
A00692-1-Fluoro647 100 µg/Vial

Anti-HEXA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 405)
MBS6191881-01 0.1 mL

PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 405)

Sign In for Pricing
View Details
PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 405)
MBS6191881-02 5x 0.1 mL

PLXDC2 (Plexin Domain-containing Protein 2, Tumor Endothelial Marker 7-related Protein, TEM7R, UNQ2514/PRO6003, FLJ14623) (MaxLight 405)

Sign In for Pricing
View Details