Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SplB Protein

This splB Protein spans the amino acid sequence from region 37-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A7X3Q8

Expression Region

37-240aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENNVTKIQDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hexokinase II/HK2 Antibody Picoband® (Carrier-free Conjugate)
A01389-carrier-free 100 µg/Vial

Anti-Hexokinase II/HK2 Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
Phospho-CDC27 (Thr244) Rabbit Polyclonal Antibody (HRP)
orb503171 100 µL

Phospho-CDC27 (Thr244) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human Retinol-binding protein 5, RBP5 ELISA Kit
MBS9317796-01 48 Well

Human Retinol-binding protein 5, RBP5 ELISA Kit

Sign In for Pricing
View Details
Human Retinol-binding protein 5, RBP5 ELISA Kit
MBS9317796-02 96 Well

Human Retinol-binding protein 5, RBP5 ELISA Kit

Sign In for Pricing
View Details
Human Retinol-binding protein 5, RBP5 ELISA Kit
MBS9317796-03 5x 96 Well

Human Retinol-binding protein 5, RBP5 ELISA Kit

Sign In for Pricing
View Details
Human Retinol-binding protein 5, RBP5 ELISA Kit
MBS9317796-04 10x 96 Well

Human Retinol-binding protein 5, RBP5 ELISA Kit

Sign In for Pricing
View Details