Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli eltB Protein

This E. coli eltB Protein spans the amino acid sequence from region 22-124aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LT-B, porcine) (LTP-B)

UniProt

P32890

Expression Region

22-124aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDO-2728
C01949-100mg 100 mg

DDO-2728

Sign In for Pricing
View Details
RN5S347 Protein Vector (Human) (pPB-N-His)
PV117019 500 ng

RN5S347 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MET Protein (N-GST, Human)
P526756 100 µg

MET Protein (N-GST, Human)

Sign In for Pricing
View Details
Tetracaine Hydrochloride EP Impurity C
RM-T052203-01 10 mg

Tetracaine Hydrochloride EP Impurity C

Sign In for Pricing
View Details
Tetracaine Hydrochloride EP Impurity C
RM-T052203-02 100 mg

Tetracaine Hydrochloride EP Impurity C

Sign In for Pricing
View Details
Tetracaine Hydrochloride EP Impurity C
RM-T052203-03 25 mg

Tetracaine Hydrochloride EP Impurity C

Sign In for Pricing
View Details