Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNX16 Protein

This Human SNX16 Protein spans the amino acid sequence from region 1-344aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P57768

Expression Region

1-344aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL16 Polyclonal Antibody
E-AB-52866-01 20 µL

MRPL16 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL16 Polyclonal Antibody
E-AB-52866-02 60 µL

MRPL16 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL16 Polyclonal Antibody
E-AB-52866-03 120 µL

MRPL16 Polyclonal Antibody

Sign In for Pricing
View Details
MRPL16 Polyclonal Antibody
E-AB-52866-04 200 µL

MRPL16 Polyclonal Antibody

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL
BNC882350-100 1x 100 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3E (activation epitope) Mouse Monoclonal Antibody [Clone ID: APA1/1]
AM12005PU-N 100 µg

CD3E (activation epitope) Mouse Monoclonal Antibody [Clone ID: APA1/1]

Sign In for Pricing
View Details