Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sod1 Protein

This Rat Sod1 Protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P07632

Expression Region

2-154aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2cd3 3'UTR Luciferase Stable Cell Line
TU102957 1.0 mL

C2cd3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Spdyb Protein Vector (Mouse) (pPM-C-HA)
45249024 500 ng

Spdyb Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SNTB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2252807 1.0 µg DNA

SNTB2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Axypet Pro 2-20uL Single-Channel Pipettor
PIP2714 1 Each

Axypet Pro 2-20uL Single-Channel Pipettor

Sign In for Pricing
View Details
PRR15 Antibody
GWB-MT978F 50 µg

PRR15 Antibody

Sign In for Pricing
View Details
PLV3-CMV-SLC18B1-3xFLAG-CopGFP-Puro Plasmid
PVT72557 2 µg

PLV3-CMV-SLC18B1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details