Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DDX60 Protein

This Human DDX60 Protein spans the amino acid sequence from region 772-939aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DEAD box protein 60)

UniProt

Q8IY21

Expression Region

772-939aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGEVLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOX 1 Rabbit Polyclonal Antibody (RBITC)
orb1050437 100 µL

LOX 1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Rabbit Polyclonal CTR9 Antibody [Alexa Fluor 647]
NB100-68205AF647 0.1 mL

Rabbit Polyclonal CTR9 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans glo-4 Polyclonal Antibody
MBS7195344 Inquire

Rabbit anti-Caenorhabditis elegans glo-4 Polyclonal Antibody

Sign In for Pricing
View Details
Sir2/SIRT1 Antibody
MBS9435136-01 0.05 mL

Sir2/SIRT1 Antibody

Sign In for Pricing
View Details
Sir2/SIRT1 Antibody
MBS9435136-02 0.1 mL

Sir2/SIRT1 Antibody

Sign In for Pricing
View Details
Sir2/SIRT1 Antibody
MBS9435136-03 5x 0.1 mL

Sir2/SIRT1 Antibody

Sign In for Pricing
View Details