Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DDX60 Protein

This Human DDX60 Protein spans the amino acid sequence from region 772-939aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DEAD box protein 60)

UniProt

Q8IY21

Expression Region

772-939aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGEVLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTBP2 Antibody
orb1315742-01 30 µL

CTBP2 Antibody

Sign In for Pricing
View Details
CTBP2 Antibody
orb1315742-02 50 μL

CTBP2 Antibody

Sign In for Pricing
View Details
CTBP2 Antibody
orb1315742-03 100 µL

CTBP2 Antibody

Sign In for Pricing
View Details
ICAM5 BioAssayTM ELISA Kit (Human)
396692 96 Tests

ICAM5 BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
EMILIN2 Rabbit Polyclonal Antibody (FITC)
orb187699 100 µL

EMILIN2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human RIC8A Protein Lysate
MBS8418596-01 0.02 mg

Human RIC8A Protein Lysate

Sign In for Pricing
View Details