Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGFBR1 Protein

This Human TGFBR1 Protein spans the amino acid sequence from region 34-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TGFR-1) (Activin A receptor type II-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth factor-beta receptor type I) (TGF-beta receptor type I) (TbetaR-I)

UniProt

P36897

Expression Region

34-126aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-fluorobutanoic acid
TRC-B439485-25MG 25 mg

4-fluorobutanoic acid

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL
BNC040500-100 1x 100 µL

Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAGE1 Human qPCR Primer Pair (NM_001468)
HP232007 200 Reactions

GAGE1 Human qPCR Primer Pair (NM_001468)

Sign In for Pricing
View Details
CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]
CF809736 100 µg

CD161 (KLRB1) Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
O-Ethylsaccharin
TRC-E187125-250MG 250 mg

O-Ethylsaccharin

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500131 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details